PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00013170-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 327aa    MW: 36328.8 Da    PI: 6.2526
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00013170-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.7e-152168148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l ++  + G g+W+ +a+  g+ R++k+c++rw +yl
  WALNUT_00013170-RA 21 KGLWSPEEDDKLMNYMLKNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 68
                        678*******************************************97 PP

2Myb_DNA-binding48.71.8e-1574116145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rg+++++E+ l+++++ +lG++ W+ Ia++++ gRt++++k++w+
  WALNUT_00013170-RA  74 RGAFSPQEEALIIHLHSLLGNR-WSQIAARLP-GRTDNEIKNFWN 116
                         89********************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-241471IPR009057Homeodomain-like
PROSITE profilePS5129417.3721668IPR017930Myb domain
SuperFamilySSF466892.66E-2819115IPR009057Homeodomain-like
SMARTSM007177.8E-112070IPR001005SANT/Myb domain
PfamPF002493.1E-142168IPR001005SANT/Myb domain
CDDcd001674.40E-92468No hitNo description
PROSITE profilePS5129424.59369123IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2572123IPR009057Homeodomain-like
SMARTSM007174.0E-1573121IPR001005SANT/Myb domain
PfamPF002491.2E-1474117IPR001005SANT/Myb domain
CDDcd001671.42E-1076116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MRKPEPFSAG KDNHSNNKLR KGLWSPEEDD KLMNYMLKNG QGCWSDVAKN AGLQRCGKSC  60
RLRWINYLRP DLKRGAFSPQ EEALIIHLHS LLGNRWSQIA ARLPGRTDNE IKNFWNSSVK  120
KRLKTLSATT SSTSTSDSSS PKDGMGSGLM ISMQEQGIMP IMYMDSSSAS SSMQNMAGLN  180
HMVDPLHMLQ HGLNMSSACT GCLNTPQYMT QIGVGTGDSF DGENGAFGGL DIGLGELFVP  240
PLESVNVEDQ KAKTENTNKW STNNNTGLYN TNNISNYNNN INARAENLAR VNGNCWEVDQ  300
ELRMGEWDLE ELMKDVPSFS LVDFQIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271612322128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7112841e-104KP711284.1 Betula platyphylla MYB transcription factor 46 (MYB46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015571138.11e-117PREDICTED: transcription factor MYB46
TrEMBLD7SL501e-117D7SL50_VITVI; Putative uncharacterized protein
STRINGVIT_06s0004g02110.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-70myb domain protein 46